DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and ehd2b

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_956357.1 Gene:ehd2b / 337401 ZFINID:ZDB-GENE-030131-9347 Length:543 Species:Danio rerio


Alignment Length:194 Identity:59/194 - (30%)
Similarity:86/194 - (44%) Gaps:24/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KVLPPSLLSSLTGDVPSMTPRGSTSSLSPLDPLKGIVPAVAPVVPVVAPPVAVATVISPPGVSVP 153
            |.|.|:|:        :|.....:|.::.|.||.......|.|.|.|.....:.|...|   .|.
Zfish   370 KALKPNLM--------NMLDELLSSDIAKLMPLLRQEEIEAGVQPGVQGGAFLGTRAGP---FVE 423

  Fly   154 SGPTPPTSNPPSRHTSISERAPSIESVNQGEWAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGV 218
            ..|....:|   .:..:.|        ...||.| ...|.||.::| .|.....|.|:|::|:..
Zfish   424 GDPFGEVAN---ENGEVGE--------EDEEWVV-TKDKPKYDEIF-YNLAPNEGKLSGTKAKDW 475

  Fly   219 LVQSKLPQVTLAQIWTLSDIDGDGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKIK 282
            :|.::||...|.:||.|||:|.||.|:.:||.||..|.|..:.|..:|..||...|||:.|:.|
Zfish   476 MVSTRLPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEVKLDGHGLPPELPARLVPPSKRRQK 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477 4/11 (36%)
EH 18..83 CDD:238009
EH 184..279 CDD:197477 38/94 (40%)
EH 195..261 CDD:238009 26/65 (40%)
GBP_C <366..467 CDD:303769
TACC 369..570 CDD:282818
coiled coil 432..443 CDD:293879
coiled coil 457..467 CDD:293879
TBPIP <495..589 CDD:284512
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
ehd2bNP_956357.1 EHD_N 22..54 CDD:293485
EHD 58..298 CDD:206740
EH 443..536 CDD:197477 38/94 (40%)
EH 453..517 CDD:238009 26/64 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.