DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and PACSIN3

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_001171903.1 Gene:PACSIN3 / 29763 HGNCID:8572 Length:424 Species:Homo sapiens


Alignment Length:398 Identity:76/398 - (19%)
Similarity:139/398 - (34%) Gaps:83/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 LDRRRKIM-EDQQRKEREERERKEREEAD--KREKARLEAERKQQEELERQLQRQREIEMEKEEQ 401
            |:.|.|:. :|.:|....:|....|....  :..:|..:..||.|:.   .|:|.:|:|..|:..
Human    96 LEVREKLQGQDSERVRAWQRGAFHRPVLGGFRESRAAEDGFRKAQKP---WLKRLKEVEASKKSY 157

  Fly   402 RKRELEAKEAARKELEKQRQQEWEQARIAEMNAQKEREQERVLKQKAHNTQLNVELSTLNEKIKE 466
            .....:.|.|..:|...:......|.::.::..:.||..:...|.||...|...||.....:..|
Human   158 HAARKDEKTAQTRESHAKADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYME 222

  Fly   467 LSQRICDT-----RAGVTNVKTVIDGMRTQRDTSMSEMSQLKARIKEQNAKLLQLTQERAKWEAK 526
            ..::..:|     |..:...|.::..:....|.|.||......|...|..:... .:|..:|...
Human   223 DMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAAS-DEEDLRWWRS 286

  Fly   527 SKASGAALGGENAQQEQLNAAFAHKQLIINQIKDKVENIS-KEIESKKEDINTNDVQMSELKAEL 590
            :...|.|:.....::..|               |....|| ||...:..|               
Human   287 THGPGMAMNWPQFEEWSL---------------DTQRTISRKEKGGRSPD--------------- 321

  Fly   591 SALITKCEDLYKEYDVQRTSVLELKYNRKNETSVSSAWDTGSSSAWEETGTTVTDPYAVASNDIS 655
                          :|..||::..:...........:..||....|.:.    ..|...|:.   
Human   322 --------------EVTLTSIVPTRDGTAPPPQSPGSPGTGQDEEWSDE----ESPRKAATG--- 365

  Fly   656 ALAAPAVDLGGPAPEGFVKYQAVYEFNARNAEEITFVPGDIILVPLEQNAEPGWLAGEI-NGHTG 719
                             |:.:|:|::..:.|:|::|..|:.:|...|:: |.||..|:: :|..|
Human   366 -----------------VRVRALYDYAGQEADELSFRAGEELLKMSEED-EQGWCQGQLQSGRIG 412

  Fly   720 WFPESYVE 727
            .:|.:|||
Human   413 LYPANYVE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477
EH 195..261 CDD:238009
GBP_C <366..467 CDD:303769 21/102 (21%)
TACC 369..570 CDD:282818 41/206 (20%)
coiled coil 432..443 CDD:293879 2/10 (20%)
coiled coil 457..467 CDD:293879 1/9 (11%)
TBPIP <495..589 CDD:284512 16/94 (17%)
SH3_Intersectin_1 674..728 CDD:212770 18/55 (33%)
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
PACSIN3NP_001171903.1 BAR 16..273 CDD:416402 38/179 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..184 4/28 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..364 11/85 (13%)
SH3 365..420 CDD:418401 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.