DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and CG33228

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_001286854.1 Gene:CG33228 / 2768732 FlyBaseID:FBgn0261373 Length:215 Species:Drosophila melanogaster


Alignment Length:109 Identity:21/109 - (19%)
Similarity:39/109 - (35%) Gaps:47/109 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 APVDAQVATVADTYNDNINTSSIPAASADLTAAGDVEYYIAAYPYES-----------------A 789
            ||:::.|     |:..||:|::....:|           :|||.|.:                 :
  Fly    63 APIESYV-----TWTKNISTATTTVLAA-----------VAAYHYATTINYLDMVQKMDIAILVS 111

  Fly   790 EEGDLSFSAGEMVMV--------------IKKEGEWWTGTIGSR 819
            :|.||.:..|..:::              |.|..|.:....||:
  Fly   112 QESDLYYFVGGFLLINLAIRAFVAKYPLRIYKSSEKYVAVYGSQ 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477
EH 195..261 CDD:238009
GBP_C <366..467 CDD:303769
TACC 369..570 CDD:282818
coiled coil 432..443 CDD:293879
coiled coil 457..467 CDD:293879
TBPIP <495..589 CDD:284512
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772 13/72 (18%)
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
CG33228NP_001286854.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0127
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.