DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and SH3YL1

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_056492.2 Gene:SH3YL1 / 26751 HGNCID:29546 Length:342 Species:Homo sapiens


Alignment Length:326 Identity:68/326 - (20%)
Similarity:120/326 - (36%) Gaps:117/326 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 AASADLTAAGDVEYYIAAYPYESAEEGDLSFSAGEMVMVIKKEGEWWTGTIGSRTGMFPSNYVQK 830
            |...:||..|::.  :|..|.....||:::..:...|....|          || |:|       
Human   115 AKGGNLTLGGNLT--VAVGPLGRNLEGNVALRSSAAVFTYCK----------SR-GLF------- 159

  Fly   831 ADVGTASTAAAEPVESLDQETTLNGNAAYTAAPVEAQEQVY--QPLPVQEPSEQPISSPGVGAEE 893
            |.|....:...|..|:         |..:....:.|.:.::  .|.|.|             ||:
Human   160 AGVSLEGSCLIERKET---------NRKFYCQDIRAYDILFGDTPRPAQ-------------AED 202

  Fly   894 AHEDLDT-------EVSQINTQS---KTQSSEPAESYSRPMSRTSSMTPGMRAKRSEIAQVIAPY 948
            .:|.||:       |..:||.:.   :.:.|...|...:|:||                    |.
Human   203 LYEILDSFTEKYENEGQRINARKAAREQRKSSAKELPPKPLSR--------------------PQ 247

  Fly   949 EATSTEQLSLTRGQLIMIRKKTDSGWWEGELQAKGRRRQIGWFP--ATYVKVLQGGRNSGRNTPV 1011
            ::::..||              :||       ::..|.:...:|  ::|.:     |....|.|:
Human   248 QSSAPVQL--------------NSG-------SQSNRNEYKLYPGLSSYHE-----RVGNLNQPI 286

  Fly  1012 SGSRIEMTEQILDKVIALYPYKAQNDDELSFDKDDIISVLGRDEP--EWWRGELNGLSGLFPSNY 1074
                         :|.|||.::.|...:|:|...|.|:|:.:.:.  :||.|:|.|.:|:||:||
Human   287 -------------EVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANY 338

  Fly  1075 V 1075
            |
Human   339 V 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477
EH 195..261 CDD:238009
GBP_C <366..467 CDD:303769
TACC 369..570 CDD:282818
coiled coil 432..443 CDD:293879
coiled coil 457..467 CDD:293879
TBPIP <495..589 CDD:284512
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772 10/50 (20%)
SH3_Intersectin_4 941..998 CDD:212773 8/58 (14%)
SH3_Intersectin_5 1025..1077 CDD:212774 21/53 (40%)
SH3YL1NP_056492.2 SYLF_SH3YL1_like 11..209 CDD:211401 27/135 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..266 13/88 (15%)
SH3_SH3YL1_like 287..340 CDD:212775 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.