DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and SPBC119.05c

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:NP_595286.1 Gene:SPBC119.05c / 2539945 PomBaseID:SPBC119.05c Length:296 Species:Schizosaccharomyces pombe


Alignment Length:271 Identity:65/271 - (23%)
Similarity:110/271 - (40%) Gaps:69/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 SNDISALAAPAVDLGGPAPEGFVKYQAVYEFNARNAEEITFVPGDIILVPLEQNAEPGWLAGEIN 715
            ::.::|.||..|:...|.|  ..|.::..|..|.:      |...:..:.|.||:.         
pombe    46 ASPVTAPAAQPVESSVPLP--LPKRKSSVEKRAGS------VASAVAAMSLSQNSG--------- 93

  Fly   716 GHTGWFPESYVEKLEVGEVAPVAAVEAPVDAQVATVADTYNDNINTSS-----IPAASADLTAAG 775
                       ||....|...:..|.||.....|:       ::|:|:     .|:.....||..
pombe    94 -----------EKRTPEEPRKLPGVPAPQKQSEAS-------SVNSSTEKLPPPPSYPGPNTAHK 140

  Fly   776 DVEYYIAAYPYESAEEGDLSFSAGEMVMVIKK-EGEWWTGTIGSRTGMFPSNYVQKADVGTASTA 839
            :||..:|.|.:...:.|||.|.|||:::|::. ..:||.|.:..:.|:||||||:..:   .|..
pombe   141 NVERVLAMYDFPGPDAGDLGFHAGEVIIVLEHVNNDWWRGELNGKEGIFPSNYVRLLE---DSAV 202

  Fly   840 AAEPVESLDQETTLNGNAAYTAAPVEAQEQVY------------------QPLPVQEPSEQPISS 886
            .|:|.....|: .....|:.:|.|::.|:..|                  ||:.|.:|:|...||
pombe   203 KAQPPPPPPQQ-NYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAYPQAPQQPIVVAQPTEHKHSS 266

  Fly   887 ------PGVGA 891
                  .|:|:
pombe   267 TFKKIGSGLGS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477
EH 195..261 CDD:238009
GBP_C <366..467 CDD:303769
TACC 369..570 CDD:282818
coiled coil 432..443 CDD:293879
coiled coil 457..467 CDD:293879
TBPIP <495..589 CDD:284512
SH3_Intersectin_1 674..728 CDD:212770 7/53 (13%)
SH3_Intersectin_3 779..830 CDD:212772 20/51 (39%)
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
SPBC119.05cNP_595286.1 SH3 142..195 CDD:214620 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.