DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dap160 and FNBP1

DIOPT Version :9

Sequence 1:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster
Sequence 2:XP_011516701.1 Gene:FNBP1 / 23048 HGNCID:17069 Length:650 Species:Homo sapiens


Alignment Length:579 Identity:113/579 - (19%)
Similarity:194/579 - (33%) Gaps:196/579 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 NKRKENYVKGQAEL---DRRRKIMEDQQRKERE-ERERKEREEADKREKARLEAERKQQEELERQ 387
            |..:.|...||.|:   :...:|:.|..|..:| ::|||......::.:..:|...||.|..:|:
Human    76 NLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRR 140

  Fly   388 LQRQREIEMEKEEQRKRELEAK-EAARKELEKQRQQEWEQARIAEMNAQKEREQERVLKQKAHNT 451
            .:|..: |.::.:|...:::|. ...:.::||.||    ||:|....|:..:.....:.||.::.
Human   141 FERDCK-EADRAQQYFEKMDADINVTKADVEKARQ----QAQIRHQMAEDSKADYSSILQKFNHE 200

  Fly   452 Q---LNVELSTLNEKIKELSQR----------------------ICDTRAGVTNVKTVID----- 486
            |   .:..:..:.:||:|:.:|                      |.....|:......||     
Human   201 QHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDS 265

  Fly   487 ---------GMRTQRDTSMSEMSQLKARIKEQNAKLLQLTQERA------KWEAKSK-------- 528
                     |.....|....:.:|...|....|:    |:..|.      |:..|||        
Human   266 QLVIEAYKSGFEPPGDIEFEDYTQPMKRTVSDNS----LSNSRGEGKPDLKFGGKSKGKLWPFIK 326

  Fly   529 ---------------------ASGAAL--GGEN--AQQEQLNAAF-------------------- 548
                                 ||.:|:  |.::  .|:|.|:..|                    
Human   327 KNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGT 391

  Fly   549 ----AHKQLIINQI---------KDKV-----------------ENISKEIESKKEDINTNDVQM 583
                .||:|:...|         :|.|                 |...|:::.|.:::|      
Human   392 QSFCFHKELMKRTIGKPTYAFEARDYVLSLKLGATPEDFSNLPPEQRRKKLQQKVDELN------ 450

  Fly   584 SELKAELSA--LITKCEDLY---------KEYDVQRTSVLELKYNRKNETSVSSAW--------D 629
            .|::.|:..  .|||.:|:|         ...|.:...|.:.....:.||....||        .
Human   451 KEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLP 515

  Fly   630 TGSSSAWEETG-------TTVTD-----------PYAVASNDISALAAPAVDLGG------PAPE 670
            ..|..|..::|       .||.:           .|....:..|.:...|.|...      |.|.
Human   516 ARSEQARRQSGLYDSQNPPTVNNCAQDRESSPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPA 580

  Fly   671 -GFVKYQAVYEFNARNAEEITFVPGDIILVPLEQNAEPGWLAGEIN-GHTGWFPESYVE 727
             |..|  |:|.|..:|...|:.|.|:.:.| :|::...||.....| ...|:.|.||||
Human   581 IGTCK--ALYTFEGQNEGTISVVEGETLYV-IEEDKGDGWTRIRRNEDEEGYVPTSYVE 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dap160NP_001246118.1 EH 7..101 CDD:197477
EH 18..83 CDD:238009
EH 184..279 CDD:197477
EH 195..261 CDD:238009
GBP_C <366..467 CDD:303769 22/104 (21%)
TACC 369..570 CDD:282818 55/329 (17%)
coiled coil 432..443 CDD:293879 1/10 (10%)
coiled coil 457..467 CDD:293879 2/9 (22%)
TBPIP <495..589 CDD:284512 28/182 (15%)
SH3_Intersectin_1 674..728 CDD:212770 19/55 (35%)
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
FNBP1XP_011516701.1 F-BAR_FBP17 5..257 CDD:153360 38/185 (21%)
HR1_FBP17 435..511 CDD:212019 17/81 (21%)
SH3_FBP17 582..637 CDD:213004 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.