DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nhe2 and NHX5

DIOPT Version :10

Sequence 1:NP_001137851.1 Gene:Nhe2 / 35376 FlyBaseID:FBgn0040297 Length:1322 Species:Drosophila melanogaster
Sequence 2:NP_175839.2 Gene:NHX5 / 841878 AraportID:AT1G54370 Length:521 Species:Arabidopsis thaliana


Alignment Length:97 Identity:20/97 - (20%)
Similarity:28/97 - (28%) Gaps:48/97 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DTSMDTLYWCKILKAPTLREKHHIIGYEALLTKESSTKQPLVHHMTLFECSTNSYPGSDPNSWDV 179
            |...|..|.|  |.|.:..|.:|::                :.||            ..|:....
plant   157 DPRQDNTYAC--LLADSFHENNHMV----------------IAHM------------HAPSRQIY 191

  Fly   180 WV-KSSGAVCNSNLLTPRDWDSCITPVATWGV 210
            :| ||:|           |||.      .|.|
plant   192 YVAKSNG-----------DWDQ------NWSV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nhe2NP_001137851.1 Na_H_Exchanger 189..704 CDD:470090 5/22 (23%)
NHX5NP_175839.2 Na_H_Exchanger 27..>445 CDD:470090 20/97 (21%)

Return to query results.
Submit another query.