DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9257 and F44E2.4

DIOPT Version :10

Sequence 1:NP_610087.2 Gene:CG9257 / 35375 FlyBaseID:FBgn0032916 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_498952.1 Gene:F44E2.4 / 176243 WormBaseID:WBGene00018418 Length:1283 Species:Caenorhabditis elegans


Alignment Length:164 Identity:33/164 - (20%)
Similarity:52/164 - (31%) Gaps:58/164 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TTFGYDLPSDGDGDYALIMKF-CEVYFDAPQKKVFDVLLNRKHTVVRQLDIYNEVGRGSAHDEI- 181
            ||.....|:||.|:..|:... ||.:.|              ....|.:.|   :|..|..|:. 
 Worm  1036 TTESPSTPTDGCGESGLVEYLQCETHLD--------------QFAFRPISI---IGDASKWDQFC 1083

  Fly   182 -----VYFKINNG-RLNYE-------GEVSDVRNGRLRL------------------------DF 209
                 .|.....| :..||       |.:..:.|.::.|                        ||
 Worm  1084 QMANQTYIPCVEGLKCKYEPAASAQIGLIDSICNRKITLKDQKQHGMCLSEYTKSDAGVACISDF 1148

  Fly   210 IKGALDNPKINAFALLKGDISQVPRMHGTEATER 243
              |.:|....::.|.:...|:||.|...:|..:|
 Worm  1149 --GKIDQLDSSSPAQMCDGINQVMRCSTSEIEKR 1180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9257NP_610087.2 Malectin 60..222 CDD:432024 26/141 (18%)
F44E2.4NP_498952.1 LDLa 11..43 CDD:238060
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.