DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9257 and F44E2.4

DIOPT Version :9

Sequence 1:NP_610087.2 Gene:CG9257 / 35375 FlyBaseID:FBgn0032916 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_498952.1 Gene:F44E2.4 / 176243 WormBaseID:WBGene00018418 Length:1283 Species:Caenorhabditis elegans


Alignment Length:164 Identity:33/164 - (20%)
Similarity:52/164 - (31%) Gaps:58/164 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TTFGYDLPSDGDGDYALIMKF-CEVYFDAPQKKVFDVLLNRKHTVVRQLDIYNEVGRGSAHDEI- 181
            ||.....|:||.|:..|:... ||.:.|              ....|.:.|   :|..|..|:. 
 Worm  1036 TTESPSTPTDGCGESGLVEYLQCETHLD--------------QFAFRPISI---IGDASKWDQFC 1083

  Fly   182 -----VYFKINNG-RLNYE-------GEVSDVRNGRLRL------------------------DF 209
                 .|.....| :..||       |.:..:.|.::.|                        ||
 Worm  1084 QMANQTYIPCVEGLKCKYEPAASAQIGLIDSICNRKITLKDQKQHGMCLSEYTKSDAGVACISDF 1148

  Fly   210 IKGALDNPKINAFALLKGDISQVPRMHGTEATER 243
              |.:|....::.|.:...|:||.|...:|..:|
 Worm  1149 --GKIDQLDSSSPAQMCDGINQVMRCSTSEIEKR 1180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9257NP_610087.2 Malectin 60..222 CDD:288557 26/141 (18%)
F44E2.4NP_498952.1 LDLa 11..43 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3593
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.