DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and pkdc

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:344 Identity:69/344 - (20%)
Similarity:122/344 - (35%) Gaps:82/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HQDVSNSDTGFDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQLTF-FSKSAPVGNESR 84
            |||:...:.|...:....| .....:|| |..:.:|:......|..|:.:.| .::..|.|..:.
Zfish     5 HQDLVLKECGAKSLQIGAK-IQTLWSGY-GEIIRVHLEGCDRPSVVVKHVMFPQNQKHPGGWNTD 67

  Fly    85 MEYLEDFGVFEKEIAVYQNVLPDLHKACAEVAPKCY----YADKNLLIFENLADQGYRMGAGRDG 145
            :.:......::.|...|||.  ..::.|.  .|.|.    :.::.|::.|:|...|:.:   |..
Zfish    68 ISHQRKVRSYQVETYWYQNY--TTNENCR--VPLCLAAKSFGEEQLIVLEDLDVAGFPV---RKT 125

  Fly   146 LLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSV--VENAYPSDVSPEHMRMVNFQNAC 208
            .:...::..||..:|..||           ......|:.:  :...:..:..||.:..::.|.  
Zfish   126 YVNDAEIKACLSWIANFHA-----------LFLDVTPEGLWPIGTYWHLETRPEELEAMSDQK-- 177

  Fly   209 LVLKEFIKLIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEV 273
                     :.....::|.:|.|...|                ||:|||....|  |.:.:.|  
Zfish   178 ---------LKAAAGEIDSILNNCRFK----------------TIVHGDAKLAN--FCFSKDG-- 213

  Fly   274 PLQCRLVDFQLARYAPPVLDVLTVL-TIPTSKE-------FRDAHLSEL------------LAEY 318
             ||...||||.......:.||:..| :....:|       ..|.:.|||            |.:.
Zfish   214 -LQVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYYFSELRKSLEKKVDFAELEKE 277

  Fly   319 YRFMTEFLKRADLDIARFI 337
            :|.|..|   |..|..||:
Zfish   278 WRNMFAF---AWTDFHRFL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 56/297 (19%)
APH <252..325 CDD:279908 25/92 (27%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 42/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.