DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG31370

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:379 Identity:82/379 - (21%)
Similarity:157/379 - (41%) Gaps:86/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHKACAE------VAPKC-YYA 122
            |.:.|..|||||..:  ::.:|......:|:.||.:|:.|||:..:...|      :..:| ||:
  Fly    61 EYITQKGFFSKSLII--KTVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYS 123

  Fly   123 --DKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSV 185
              ...::|||:|.:..|.|  .||.:||:.::......||..||.|:        ||...:|:.|
  Fly   124 LEPSQVMIFEDLGEMDYAM--VRDRVLTHGEICGAYSKLAKFHALSM--------KIINERPEFV 178

  Fly   186 VENAYPSDVSPEHMRMVNFQNA-CLV-----------LKEFIKLIP---KYQSKLDYVLENFTEK 235
            .|                |::. |||           .|:|:..||   :|::..:.:..:|.::
  Fly   179 KE----------------FKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDR 227

  Fly   236 MSFIFEAVKTSDVYQNTIL-HGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLT 299
            :..|.:..:|:......:| |||....|||.::.:.......|.|:|:|....||...|::..:.
  Fly   228 LRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIY 292

  Fly   300 IPTSKEFRDAHLSELLAEYYRFMTEFLKRADLDIARFIPE-QTFYESVQKFRSVGLIESCLFCHL 363
            :..::|.|...|..||..|:..:.|.|::  :.....:|: ..|::.:.:.:....:        
  Fly   293 MLMNREQRIGELETLLNYYFSVLRETLRK--IGYQGKLPDPPAFWKEMYRLKDYEFL-------- 347

  Fly   364 VILPPHCTQKLTSSVDGFNDFFTNKRIEICLEAFNTDELYRSRLVDMIEDFVDQ 417
                             |...:....:.:.||....:|     ..|.::||:::
  Fly   348 -----------------FLSTYLPMSVGLSLETATNEE-----TDDKLQDFIEE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 73/287 (25%)
APH <252..325 CDD:279908 20/73 (27%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 73/292 (25%)
APH <202..320 CDD:279908 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.