DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG13658

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:417 Identity:102/417 - (24%)
Similarity:168/417 - (40%) Gaps:86/417 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DAPAGYLGSHLY------------LHVT-LKL---------HNSEEVRQLTFFS----------- 74
            |||| :|.:.|.            |||| ||:         :.|...|.::.:|           
  Fly    16 DAPA-WLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSKALI 79

  Fly    75 -KSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHKACAEV-------APKCYYA--DKNLLIF 129
             |:.|.....:.:.|.:..:|:.||.:|...||:|.:...|.       ||..|::  ...::||
  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIF 144

  Fly   130 ENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDV 194
            |:|..|||.:  .||.....|:|......||..||.|:        |:...:|..:.|..|..  
  Fly   145 EDLVPQGYTV--IRDRYPNKEELQKAFFKLAKWHAASM--------KVLNERPDFLKEFKYGL-- 197

  Fly   195 SPEHMRMVNFQNACLV------LKEFIKLIP---KYQSKLDYVLENFTEKMSFIFEAVKTSDVYQ 250
                ..|.||.|..:|      ..|.:..:|   ||:...:.:.:|:.::||.:.|..:|:....
  Fly   198 ----WGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPN 258

  Fly   251 N--TILHGDLWANNIMFQY----GRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDA 309
            .  .:.|||....|:||:|    |.:.:|    .|||||::...|..:|::..:.:....|.|..
  Fly   259 RYYVLCHGDFHGRNMMFRYNKETGSFEDV----MLVDFQISNVCPLSIDLIYSIFMVMDTEDRWD 319

  Fly   310 HLSELLAEYYRFMTEFLKRADLDIARFIPEQT-FYESVQKFRSVGLIESCLFCHLVILPPHCTQK 373
            ...|.:..|:..:.:.||:  :.....:|.|| .:|.:...:.........|..||..   ...|
  Fly   320 LGKEYINYYFSVLADTLKK--IGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAA---MNTK 379

  Fly   374 LTSSVDGFNDFFTNKRIEICLEAFNTD 400
            ...|:|.|.|..| |:....|:.:.||
  Fly   380 TFKSMDSFFDPQT-KQKSFFLDEYITD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 76/316 (24%)
APH <252..325 CDD:279908 20/76 (26%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 73/310 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.