DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG31104

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:331 Identity:81/331 - (24%)
Similarity:133/331 - (40%) Gaps:57/331 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 APAGYLGSHLYLHVTLKLHNSEEVRQLTFFS----KSAPVGNESRMEYLEDFGVFEKEIAVYQNV 104
            :||...|.| |..|..:........:..||.    |:.|.....:.:.|.:..:||.||.:|.:.
  Fly    45 SPATAQGDH-YASVMFRTKVEYTTPKGKFFKPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHA 108

  Fly   105 LPDLHKACAEVAPK------CYY---ADKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLA 160
            ||:..:...|....      |.|   ..:.::|||:|..|||.:  .||...:...|......||
  Fly   109 LPEFERILREAGDNTKLFVPCIYHSLKPRQVMIFEDLVPQGYTV--IRDSPPSLGDLKLAFDKLA 171

  Fly   161 AMHAGSIIQEQRTGQKIAQSQPKSVVENAY-----PS-DVSP-EHMRMVNFQNACLVLKEFIKLI 218
            ..||.|:        |:...||..:.|..|     |: |..| ....|.||       .|.:..:
  Fly   172 KWHAVSM--------KVINEQPYFLKEFQYGLFEMPTIDTDPFITTGMTNF-------IEMLDKM 221

  Fly   219 P---KYQSKLDYVLENFTEKMS---FIFEAVKTSDVYQNTILHGDLWANNIMFQY----GRYGEV 273
            |   ||:...:.:.:|:.:::.   ..:...:.:|.|. .:.|||....|:||::    |.|.:|
  Fly   222 PELRKYKHHFEKIKDNYMQRLEVEMHEYHKYRRNDRYY-VLCHGDFHLRNMMFRHNKELGAYDDV 285

  Fly   274 PLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEFLK----RADLDIA 334
                .||||||:...|..:|:...:.:....|.|......|:.||:..:...|:    :.|:...
  Fly   286 ----MLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGENLINEYFSVLVATLRKIGYKGDMPTQ 346

  Fly   335 RFIPEQ 340
            |.:.||
  Fly   347 RELWEQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 72/304 (24%)
APH <252..325 CDD:279908 22/76 (29%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 75/311 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459892
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.