DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG6834

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:428 Identity:106/428 - (24%)
Similarity:169/428 - (39%) Gaps:91/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FHQDVSNSDTGFDIVNYTLKPTSDAPAGYLGSHLY---LHVTLKLHNSEEVRQLTFFSKSAPVGN 81
            |.:.:|:::..||.:......::..|.....|.|.   :...||.|.|:.      ||....|..
  Fly   504 FAEVISSAEPEFDKIVGGSWSSATKPGDNFASKLLKIDIETQLKDHTSKT------FSYILKVQP 562

  Fly    82 ESRMEYLEDFGVFEKEIAVYQNVLPD--------------------LHKACAEVAPKCYYADKNL 126
            :|..:...|..:|.||:.:||..:|.                    |:||..|          ..
  Fly   563 KSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDAGLTVTFTANSFVLNKAVKE----------EY 617

  Fly   127 LIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYP 191
            |:.|||..:|::|.....| |..|.....||.||..||.||..::..|              |||
  Fly   618 LLMENLQTKGFKMADRMKG-LNMEHTKSSLKKLAQWHAASIKYKELNG--------------AYP 667

  Fly   192 ----SDVSPEHMRMVNFQNACLVLKE-FIKLI------PKYQSKLDYVLENFTEKMSFIFEAVKT 245
                ..:..|..|.| |.|.....|| :|::.      .:|..||:::::|..::   :.|..|.
  Fly   668 PLYNDGIYIEQTRDV-FHNMFASAKEAYIRIFGTFEGADEYLPKLEWIIDNHVDQ---VLEDAKI 728

  Fly   246 SDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAH 310
            ::...|.:.|||.|.|||||||...|.:. :..|:|.|.|:|..|..|:...|......:.:...
  Fly   729 NEQAFNVLNHGDAWINNIMFQYDAEGRLK-ETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDE 792

  Fly   311 LSELLAEYYRFMTEFLKRADLDIARFIPEQTFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLT 375
            ...|:..|:..:.|..|.  |....|:|      |:.:..:: |||...|....::   .|..:.
  Fly   793 FDNLIRFYHENLVEHTKL--LKYNGFVP------SLSELHAI-LIEHPAFAVGTVI---STLTVC 845

  Fly   376 SSVDGFND--FFTNKRIEICLEAFNT----DELYRSRL 407
            .:.:|||.  ||......   |||.|    :|.|::.:
  Fly   846 LTDEGFNPELFFVETPES---EAFRTKLLGNERYKAHV 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 78/301 (26%)
APH <252..325 CDD:279908 22/72 (31%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 83/321 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.