DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG5644

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster


Alignment Length:482 Identity:104/482 - (21%)
Similarity:169/482 - (35%) Gaps:158/482 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TSDAPAGYLGSHLYLHVTLKLHNSEEVRQLTFFSKSAPV-------------------------- 79
            |..:..||.|::.|      ..|:|.:|||  ||:|..|                          
  Fly    19 TVSSAGGYDGTNQY------EENAEHLRQL--FSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRV 75

  Fly    80 --------------GNE-------------SRMEYLEDFGVFEKEIAVYQNVLPDL--HKACAEV 115
                          |:|             ||.:.......|..||..|:::.|.|  |.. .::
  Fly    76 TISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNEINAYRHLAPLLAAHSR-HQL 139

  Fly   116 APKCYYADKN----------LLIFENLADQGYRMGAGRDGLLTYEQLHCCL--KTLAAMHAGSII 168
            .|.|:.|:..          :::.::|...|:||   :|.|...|...|.|  |.||.:||.|:.
  Fly   140 FPVCHIAESQDRRDAEGGEPIIVLQDLKAMGFRM---KDRLAGLELSDCLLVMKKLAQLHAASLA 201

  Fly   169 QEQRTGQKIAQSQPKSVVENAYPSDVS-----------PEHMRMVNFQNACLVLKEFIKLIPKYQ 222
            .::......| .....:.|..|..:.:           .:.:..:...||...|...|:|:.:.:
  Fly   202 AQELESSSFA-FHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELR 265

  Fly   223 SKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARY 287
            :.|   .||...:::      .|:....:.|.|||||.|||||:     ..|.:....|.|..|.
  Fly   266 TNL---FENLKHEIN------ATAAAPNSVICHGDLWVNNIMFR-----SEPEEVIFFDLQAMRK 316

  Fly   288 APPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEFLKR--ADLDIARFIPEQTFYESVQKFR 350
            :.|:.|:|..:...|.:..||.|...|||.|.:.::|.|:.  .|...|..:.|.....|:|:..
  Fly   317 SSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLS 381

  Fly   351 S--VGLIESCLFCHLVILP---------PH---------------CTQKLTSSVDGFNDFFTNKR 389
            |  |..:...|...:.|||         |:               |||.|||.            
  Fly   382 SDYVRQVHYGLAIGMWILPAVTFDPNNLPNLDVMSEQNLTGKEIKCTQMLTSE------------ 434

  Fly   390 IEICLEAFNTDELYRSRLVDMIEDFVD 416
                         |..|:.:::.:|.:
  Fly   435 -------------YHMRIRELVMEFYE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 78/348 (22%)
APH <252..325 CDD:279908 26/72 (36%)
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 69/310 (22%)
P-loop_NTPase <357..435 CDD:304359 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.