DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG9498

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:382 Identity:96/382 - (25%)
Similarity:156/382 - (40%) Gaps:74/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SEEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLP--DLHKACAEVAPKCYYADK-- 124
            |....||:...|:.|:...:  ::|||..||.||...|.:|||  |:.........|.|::.|  
  Fly    71 SPVTEQLSLIVKTIPITEAT--QFLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTP 133

  Fly   125 -NLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVEN 188
             ..::|.:|..:|::: |.|:..|.:......|:.|...||.|::        :|:..|..|.: 
  Fly   134 VQTIVFSDLTVEGFKV-ASREKGLDWNHASLILQQLGKFHATSMV--------LAKKDPAIVKQ- 188

  Fly   189 AYPSDVSPEH--MRMVNFQNACLVLKEFIK-LI---------PKYQSKLDYVLENFTEKMSFIFE 241
             |...:..|.  |:...|:.   :...|:| ||         .|....|..:::||....:   :
  Fly   189 -YTRGMLSEDILMKSDTFEQ---MFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCA---D 246

  Fly   242 AVKTSDVYQNTIL-HGDLWANNIMFQYGRYG--EVPLQCRLVDFQLARYAPPVLDVLTVLTIPTS 303
            |.:.....:..:| |||||.||.|:.|....  :||.:...|||||:.|..|..|:...|.....
  Fly   247 APRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIK 311

  Fly   304 KEFRDAHLSELLAEYYRFMTEFLKRADLDIARF--IPEQTFYESVQ-KFRS---VGLIESCLFCH 362
            .:.......||:..||....:     .|:.|||  ||.   ||.:| :.||   .||.....|..
  Fly   312 LQLLQERREELIKVYYASFKD-----ALEYARFEDIPS---YEDLQYELRSRETYGLFGMFAFLP 368

  Fly   363 LVILPPHCTQKLTSSVDGFNDFFTNKRIEICLEAFNTDELYRSRLVDMIEDFVDQFV 419
            ::.:|....|  .:|::...                 ||.::.|.:|.|  |..:|:
  Fly   369 MITMPKELAQ--DNSIENMQ-----------------DEAFKQRKMDAI--FSQKFL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 72/283 (25%)
APH <252..325 CDD:279908 25/75 (33%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 74/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459280
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.