DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG31974

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:375 Identity:97/375 - (25%)
Similarity:160/375 - (42%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NYTLKPTSDAPAGYLGSHLYLHVTLKLHNSE-EVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEI 98
            :|..||..:     .|| :.|.|..|:.::: .:|.|...:|..|:.|:...:..:.......|.
  Fly    30 SYLTKPGDN-----YGS-IMLSVQAKIRSADGGIRDLPLIAKLPPLTNDLYWQIFQPERTCITEN 88

  Fly    99 AVYQNVLPDLHKACAEVA----------PKCYYADK-------------NLLIFENLADQGYRMG 140
            ||||.:.|:|.|...|..          |: ||..:             .:|:.||:..:|||.|
  Fly    89 AVYQYLSPELDKLQLESGILPAQIFDGFPR-YYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPG 152

  Fly   141 AGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYP--------SDVSPE 197
             .|.......:....|..||..||..|        .:...:|:...|...|        |::...
  Fly   153 -NRHRPYNLAETVLILHYLAQYHALPI--------ALRLKKPQVYEEYVRPYFKKFDMNSNIDQA 208

  Fly   198 HMRMVNFQNACLVLKEFIKLIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQN----TILHGDL 258
            ...::|.:    :||: |||:...:..::.|.|     :..||:|.:.|:...:    |::||||
  Fly   209 ETEIMNKE----ILKD-IKLVTSDERDVNRVKE-----LLDIFQAFQASNDVDDGPFTTLVHGDL 263

  Fly   259 WANNIMFQYGRYGE--VPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRF 321
            |.||:|.:||..||  .||:.::||||:|:|...|.|::.||.........:.:....|..||..
  Fly   264 WINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNA 328

  Fly   322 MTEFLKRADLDIARFIPEQTFYESVQKFRSVGLIESCLFCHLVILPPHCT 371
            ..:.|:..::|.:.:..| .|.|.||:...|.| ...:|...|||..:.|
  Fly   329 FIQTLRSVNVDTSNYTYE-LFLEEVQQTAHVQL-PHAIFMMKVILADNST 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 78/308 (25%)
APH <252..325 CDD:279908 28/74 (38%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 82/327 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.