DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG7135

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:429 Identity:101/429 - (23%)
Similarity:183/429 - (42%) Gaps:56/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATALELSPTEIRGLCQRYFHQDVSNSDTGFD--IVNYTLKPTSDAPAGYLGSHLYLHVTLKLHN 63
            |:.|||..|..   |..::|.:.:.:.....|  ::...|...:.....|. |::| ...:|..|
  Fly     1 MSDALEEPPLY---LTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYC-SNIY-RAQIKYRN 60

  Fly    64 SEE-VRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHK---------ACAEVAPK 118
            :|. ..:.:...||.|   :.:...|....::.||...|.::.|.|..         :...:|||
  Fly    61 AESCAMETSLIVKSMP---DEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPK 122

  Fly   119 CYYA---DKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQS 180
            .||:   .:..:|.|:|...||::...:.| |.::.....:..||..||.:::        :|:.
  Fly   123 HYYSTTQPEQTIILEDLCAAGYQLKCRQLG-LDFDHAALVMAKLAEYHALTMV--------MAER 178

  Fly   181 QPKSVVENAYPSDVSPEHMRMVNFQNACLVL-KEFIKL---------IPKYQSKLDYVLENFTEK 235
            :|:::|:. ||..:.  ||..:|.:...|:. .:.:||         .....:||....|:|||:
  Fly   179 EPETIVDR-YPFGLL--HMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTER 240

  Fly   236 MSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTI 300
               :.:||.......|.:.|||||.|||.|:|.....|. |.:::||||..|.....|:...|..
  Fly   241 ---VLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQ-QVKIIDFQLCFYGSLGFDINYFLNT 301

  Fly   301 PTSKEFRDAHLSELLAEYYRFMTEFLKRADLDIARFIPE-QTFYESVQKFRSVGLIESCLFCHLV 364
            ....|.......||:..|||.:.:.||.  |..::.:|. :...:.::|..:.|...:..|..|:
  Fly   302 SLELEVLRDRRQELVDIYYRSLVDCLKH--LPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLM 364

  Fly   365 ILPPHCTQKLTSSVDGFND-FFTNKRIEICLEAFNTDEL 402
            .:..  .....:|:..|:| .|..:::::..|. ||..|
  Fly   365 SMIG--VDSEDNSLKNFHDETFARQKVQLMFEG-NTRTL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 74/293 (25%)
APH <252..325 CDD:279908 25/72 (35%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 78/309 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.