DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG31300

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:409 Identity:87/409 - (21%)
Similarity:143/409 - (34%) Gaps:128/409 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PAGYLGSH---LYLHVTLKLHNSEEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLP 106
            ||...|.|   :....|.:...::.........|:.|..:..:.:.|.:..:||.||.:|..|||
  Fly    48 PASAQGDHYASVMFRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLP 112

  Fly   107 DLHKACAE-------VAPKCYYA--DKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAM 162
            :..:...|       ..|..|::  .:.::|||:|..|||.:  .||..:..|:|......||..
  Fly   113 EFERILRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQGYYV--IRDRPVAQEELKTAFAKLAKW 175

  Fly   163 HAGSIIQEQRTGQKIAQSQPKSVVENAY-----PSDVSPEHMRMVNFQNACLVL----------K 212
            ||.|:        |..:.||..:.|..|     |: |..:.......|:...:|          .
  Fly   176 HAISM--------KYIKEQPDFLKEFKYGLFEMPT-VKTDPFITTGMQSFIEMLDRLPELRKYKP 231

  Fly   213 EFIKLIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQC 277
            .|.|:..||..:|..|::.:.|.        :.||.:. .:.|||....|:||:..:........
  Fly   232 HFEKIKDKYMQRLQAVMKEYHEN--------RKSDAFY-VLCHGDFHLRNMMFKNNKGTGAHEDT 287

  Fly   278 RLVDFQLARYAPPVLDV------------------------LTVLT-----------IPT-SKEF 306
            .|||||::...|..:|:                        ||||.           :|| :|.:
  Fly   288 MLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLW 352

  Fly   307 RDAHLSELLAEYYRFM-------------------------------TEFLKRADLDIARFIPEQ 340
            .:.|.:    :||.|.                               |.||.....|:::.:|  
  Fly   353 DEIHKN----KYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVKDVSKLLP-- 411

  Fly   341 TFYESVQKFRSVGLIESCL 359
                   ||..:|..: ||
  Fly   412 -------KFEQLGYFK-CL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 76/361 (21%)
APH <252..325 CDD:279908 25/139 (18%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 68/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.