DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG31436

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:305 Identity:78/305 - (25%)
Similarity:129/305 - (42%) Gaps:34/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 APAGYLGSH---LYLHVTLKLHNSEEVRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVL 105
            :||...|.|   :.....:|..|.:...|.:...|:.|.....:.:.|....:||.|:.:|..||
  Fly    47 SPASAKGDHYASIMFRARVKYTNRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVL 111

  Fly   106 PDLHKACAEVAP------KCYY---ADKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAA 161
            |:..:...:|..      .|.|   ....:||||:||:.||.:...||.  |.:::......||.
  Fly   112 PEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFEDLAEMGYIVLRDRDA--TLDEIRRIYFKLAK 174

  Fly   162 MHAGSIIQEQRTGQKIAQSQPKSVVENAY-----PSDVSPEHMR--MVNFQNACLVLKEFIKLIP 219
            .||.|:        |:...||:.:....:     |..::...||  |..|........|..|..|
  Fly   175 WHAVSL--------KVQNEQPEFLESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKP 231

  Fly   220 KYQSKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQ-CRLVDFQ 283
            .::|..|..||...|:...|.::.|..:.:  .:.||||...||||::  ...|.|: |.|:|||
  Fly   232 YFESIKDDFLERLVEEWKDIRKSQKKDEYW--VLCHGDLHLRNIMFKH--KDTVSLEDCMLLDFQ 292

  Fly   284 LARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEFLKR 328
            ::...|...|:|..:.:....|.|..:..:|:..|...:.:.||:
  Fly   293 ISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 73/287 (25%)
APH <252..325 CDD:279908 22/73 (30%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 76/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.