DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG31288

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:423 Identity:100/423 - (23%)
Similarity:176/423 - (41%) Gaps:76/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QRYFHQDVSNSDTG-FDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSE-EVRQLTFFSKSAPV 79
            ::||...::..:.. ..::.:|:  .:..|.|...:...|.|.:||...: .|:..|:..|:. :
  Fly    22 EKYFESVLAKDEPDHVKVLKFTV--VAAIPPGENFTSTMLRVYIKLEMKDGSVKTKTYIFKTM-L 83

  Fly    80 GNESRMEYLEDFGVFEKEIAVYQNVLP---DLHKACA---EVAPKCYYADKN----LLIFENLAD 134
            ..|.....:.:||:|.||..:|:..||   .|:|...   ::||||.:.::.    ..|||:|..
  Fly    84 PEERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEEREGDIHFIFEDLCV 148

  Fly   135 QGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDVSPEHM 199
            :.:: ...|...|..|.:..||:.||..||.|.:.|:..|     ..|....|.....||...|:
  Fly   149 KRFK-NMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHG-----PYPSEFSEGFVKKDVKKFHV 207

  Fly   200 RMVNFQNACLVLKEFIKLIPKYQSK-LDYVLENFTEKMSFIFEAVKTSDVYQ---NTILHGDLWA 260
            .  .||   |..|.:.|.:..:..| .|..::.|.....:..:.:.|.::..   :.:.|||.|:
  Fly   208 D--GFQ---LKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWAQCLSTLELNPDEFHVLNHGDFWS 267

  Fly   261 NNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEF 325
            :|:|..|...|.:. :..|:|||:..:..|.:|:|..||:..:.:.|.......:..|:..:.|.
  Fly   268 SNLMSSYLPDGTLE-KLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVEC 331

  Fly   326 LKRADLDIARFIPE------------QTFYESVQKFRSVGLIESCLFCHL-VILPPHCTQKLTSS 377
            ||  .|.:.:.:|:            .:||    .|.|:       ..|| :||.|         
  Fly   332 LK--VLKLKKPLPKLRDLQNSMNNKNHSFY----AFFSI-------LNHLPIILFP--------- 374

  Fly   378 VDGFNDFFTNKRIEICLEAFNTD--ELYRSRLV 408
                    |:|...|...:.||:  |.||.||:
  Fly   375 --------TDKDSNIHNLSANTEEGENYRLRLL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 72/285 (25%)
APH <252..325 CDD:279908 19/72 (26%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 72/293 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459665
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.