DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and CG32195

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:368 Identity:86/368 - (23%)
Similarity:150/368 - (40%) Gaps:76/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FSKSAPVGNESRMEYLED-------FGVFEKEIAVYQNVLPDLHKACAEVAPK----------CY 120
            |.:|.....||....|:|       .|..||:  :::.:||.: :|..|.|||          |.
  Fly    52 FRRSPDGALESGKYILKDLLPAAAALGTNEKD--MFEVLLPAM-QAILEEAPKEIGEHKLSADCL 113

  Fly   121 Y----ADKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQ 181
            .    |.|.|.|.|:|...||.....|.| |..|:...|::.||..|..|.:..::..:.|.:..
  Fly   114 LVEISAGKELYILEDLGALGYESFDRRQG-LNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLS 177

  Fly   182 PKSVVENAYPSDVSPEHMRMVNFQNACLVLKEFIKLIPKYQSKLD-YVLENFTEKMSFIFEAVKT 245
            |     :.|.:.::....:.:..:.|....:.|.:.:|:...|:. .:.:.:|::|..:.:..|:
  Fly   178 P-----SHYANGLNDRFAQALVLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDVVDPNKS 237

  Fly   246 SDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAH 310
            |   .|.::|||.|.|||||.:     |..:..|||||...:..|.:|:..:.......|....:
  Fly   238 S---LNAVIHGDPWLNNIMFDF-----VNKKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNN 294

  Fly   311 LSELLAEYYRFMTEFLKRADLDIARFIPEQTFYESVQKFRSV-GLIESCLF-------CHLVILP 367
            ..|||..|:..:.|.|:...           :.:::..|..: ..::.|||       |.|    
  Fly   295 QDELLNYYFDNLLETLRHCG-----------YKDTLPTFGQLKDEMKRCLFYGYYTVVCEL---- 344

  Fly   368 PHCTQKLTSSVD-GFNDF-------------FTNKRIEICLEA 396
            |.|.....:||| |.:.|             |.::|:...::|
  Fly   345 PICCASPEASVDFGVHTFVDTDAMLKKRHQLFASERVRQTIKA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 70/276 (25%)
APH <252..325 CDD:279908 22/72 (31%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 70/290 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.