DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and H06H21.8

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:270 Identity:56/270 - (20%)
Similarity:114/270 - (42%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NESRMEYLEDFGVF--EKEIAVYQNV----LPDLHKACAEVAPKCYYAD------KNLLIFENLA 133
            :||.:.:|.|..::  :||...|::.    :|:.      ..||.|:.:      ...::.|||:
 Worm    77 DESAVNHLNDVLLYYSKKENLFYKHFEYGSIPNF------PFPKVYFTEDINGEATGGIVAENLS 135

  Fly   134 DQGYRM----GAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSDV 194
            ::.:.:    |      |.:||:...::.||.:|:..:.::.:       |..:|.||.|:..:.
 Worm   136 EKVFAVEHIPG------LKHEQILRLMEALAGLHSFLMKRDDK-------SYVESFVEGAHGRET 187

  Fly   195 SPEHMRMVNFQNACLVLKEFI------KLIPKYQSKLDYVLENFTEKMSFIFEAVKTSD---VYQ 250
            ..|.|:.:.|:.| |.|:...      ..|...:...||.::|           ..|:|   .:.
 Worm   188 FSEGMQNMMFEEA-LTLENVSPEVFGNDRIRNIKWSFDYSIKN-----------KATADAISAFP 240

  Fly   251 NTILHGDLWANNIMFQY-GRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSEL 314
            ..|.|.||...|::::. ....|:   ..::|:|:........|::.|||:..::|.|.......
 Worm   241 GIICHADLNVTNVLWKKDSAKDEI---SAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNY 302

  Fly   315 LAEYYRFMTE 324
            |..|::.:||
 Worm   303 LDHYHKTLTE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 56/270 (21%)
APH <252..325 CDD:279908 18/74 (24%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 43/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.