DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9259 and dhs-27

DIOPT Version :9

Sequence 1:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:225 Identity:45/225 - (20%)
Similarity:72/225 - (32%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NESRMEYLEDFGV--------FEKEIAVYQNVLP-DLHKA-------CAEVAPKCYYADKNLLIF 129
            |.::.|.:|..|.        |||:..   :.|| ||...       ||.:||........|.  
 Worm    88 NNTKKELVEQHGCEVMCHVHDFEKDDL---SALPKDLETLDVGILINCAGIAPHIIGTLTELP-- 147

  Fly   130 ENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQ-EQRTGQK---IAQSQPKSVVENAY 190
            |.||.:..|:..    :...:.....|..:.....|.|:. ...||.:   ...|.|.|....::
 Worm   148 EGLASKILRVNL----MSAVKMTEMILPNMVKKKRGIIVNISSMTGWRPLPYLSSYPASKAALSF 208

  Fly   191 PSDVSPEHMRMVNFQNACLVLKEFIKLIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQNTILH 255
            .||...:..|....:..||:.......:..|::          |:.:.||.....:...|...:.
 Worm   209 FSDSLSDEYRGTGIRVQCLIPMLVATKVASYEA----------EEANNIFVVTPENFAKQAVRII 263

  Fly   256 GDLWANNIMFQYGRYGEVPLQCRLVDFQLA 285
            |..|            |:...|...|.|:|
 Worm   264 GTNW------------EITTGCVQHDVQVA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 45/225 (20%)
APH <252..325 CDD:279908 7/34 (21%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 45/225 (20%)
adh_short 50..234 CDD:278532 33/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.