DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and SLC7A6

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001070253.1 Gene:SLC7A6 / 9057 HGNCID:11064 Length:515 Species:Homo sapiens


Alignment Length:430 Identity:72/430 - (16%)
Similarity:136/430 - (31%) Gaps:136/430 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGARLALGASVISYL-------IVYNEASAPSLLVGVV--LATVYGAMA-ARCKTSLRSLQMPYV 68
            :|..|.:|..:.|.:       :|:..:...||:|..:  |.:|.||:. |...|::......|.
Human    49 NGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYA 113

  Fly    69 RATNKFDFSCLFLAIWLDALAT---------------------------VCACAALARTLSACLD 106
            .....|.....|:.:|:..|..                           ..||..||   :||:.
Human   114 YILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLA---AACIC 175

  Fly   107 AMTGGLARILILGRNAPANEPWPDVLGVSVVFLVTGMFMLGLEHSRAFSLI----------LTLG 161
            .:|......:..|........:..|:.: :..:|.|:..|...||..|...          |:|.
Human   176 LLTFVNCAYVKWGTRVQDTFTYAKVVAL-IAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLA 239

  Fly   162 MFGLNAILSAVGWWRGDMLAWSADSYFQPDGISSVFLGTALLTYSFPGDWPQQLRGGRFTATLIT 226
            ::  :|:.|..||   |.|.:..:....|:....:.:|     .|.|                  
Human   240 LY--SALFSYSGW---DTLNFVTEEIKNPERNLPLAIG-----ISMP------------------ 276

  Fly   227 GLVSTSLLLTAICLSTVVHYRS--QEDYVAVP--------------------------------- 256
             :|:...:||.:...||::...  ..|.|||.                                 
Human   277 -IVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASS 340

  Fly   257 -LFNILDENG----------FHKLVPASACMLLLTSSAAFLELFPELYGIVVRLATSEWRILSKQ 310
             ||.:....|          ..:..|..|.:...|.:..:| :..:::.::...:.|.|..:...
Human   341 RLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYL-IVEDVFQLINYFSFSYWFFVGLS 404

  Fly   311 I------SYESSESGNPV-LAVF--IAGSMCAMLAFACPL 341
            :      .::..:...|: |:||  |...:|::.....||
Human   405 VVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 45/241 (19%)
SLC7A6NP_001070253.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
2A0308 17..501 CDD:273332 72/430 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.