DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and CAN1

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_010851.1 Gene:CAN1 / 856646 SGDID:S000000789 Length:590 Species:Saccharomyces cerevisiae


Alignment Length:398 Identity:73/398 - (18%)
Similarity:134/398 - (33%) Gaps:130/398 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FSLILTLGMFGLNAILSAVG--WWRGDMLAWSADSYFQPDGISSVFLGTALLTYSFPGDWPQQLR 216
            |.::...|:.|      .||  :||... || .......|.....|||           |...|.
Yeast   246 FCMVCGAGVTG------PVGFRYWRNPG-AW-GPGIISKDKNEGRFLG-----------WVSSLI 291

  Fly   217 GGRFT--ATLITGL----------------------VSTSLLLTAICLSTVVHYRSQE-----DY 252
            ...||  .|.:.|:                      :.|..:.:.:.:..:|.|...:     .|
Yeast   292 NAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY 356

  Fly   253 VAVPLFNILDENGFHKLVPASACMLLLTS--SAAFLELFPELYGIVVRLATSEWRILSKQISYES 315
            |:...|.|..||...|::|.....::||:  |||...::   .|..:....|:.::..|.:| .:
Yeast   357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIY---VGSRILFGLSKNKLAPKFLS-RT 417

  Fly   316 SESGNPVLAVFIAGSMCAMLAFACPLQH-------LSYTLAAGHMGGVFLRALYLLY-------- 365
            ::.|.|.:|||:..:..|:.........       |:.|..||....:|:...::.:        
Yeast   418 TKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482

  Fly   366 -----IPYRPKYMAPSSESSLSYSRL--------STAPFAKSSSYSSAATSSSSRLK-------- 409
                 :|::.|.|...:..:.::..:        :.||.....|:::|..|....|.        
Yeast   483 ISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCI 547

  Fly   410 ---RSLWKIGLPKHSNLKKPKTKPRNKQELEKEWLLLGEPTSPCPQREGRDVESTILSDGEPPPS 471
               |.:||||                  :::.:             .:.||:|:.:..|.||.  
Yeast   548 FRCRFIWKIG------------------DVDID-------------SDRRDIEAIVWEDHEPK-- 579

  Fly   472 DFEYPDKF 479
              .:.|||
Yeast   580 --TFWDKF 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 13/56 (23%)
CAN1NP_010851.1 2A0310 85..562 CDD:273334 64/356 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.