DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and PUT4

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_014993.1 Gene:PUT4 / 854530 SGDID:S000005875 Length:627 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:55/231 - (23%)
Similarity:83/231 - (35%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGASVISYLIVYNEASAPSLLVGVVLATVYGAMAARCKTSLRSLQMPYVRATNKFDFSCLFLAIW 84
            ||...||.::.||:   |:|    |.|...|...|.....:..:|...::........|:..:.|
Yeast   361 LGTLAISVIVPYND---PTL----VNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAW 418

  Fly    85 LDALATVCACAALARTLSACLDAMTGGLARILILGRNAPANEPWPDVLGVSVVFLVTGMFMLGLE 149
            ..|.|.:     .|.|.|....|.||...:  .|||......|:   :.|.|.||.:.:..|.:.
Yeast   419 SAANAFM-----FASTRSLLTMAQTGQAPK--CLGRINKWGVPY---VAVGVSFLCSCLAYLNVS 473

  Fly   150 HSRA-----FSLILTLGMFGLNAILSAVGWWRG-----------------DMLAWSADSYFQPDG 192
            .|.|     ||.|.|:..|        :||..|                 |.|.:.  ::.||..
Yeast   474 SSTADVFNWFSNISTISGF--------LGWMCGCIAYLRFRKAIFYNGLYDRLPFK--TWGQPYT 528

  Fly   193 I--SSVFLGTALLTYSFPGDWPQQLRGGRFTATLIT 226
            :  |.:.:|...:|..:....|:..|...|.|..||
Yeast   529 VWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYIT 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 49/212 (23%)
PUT4NP_014993.1 2A0310 107..593 CDD:273334 55/231 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.