DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and AGP2

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_009690.1 Gene:AGP2 / 852429 SGDID:S000000336 Length:596 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:54/277 - (19%)
Similarity:97/277 - (35%) Gaps:74/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GVVLATVYGAMAARCKTSLRSLQMPYVRATNKFDFSCLFLAIWLDALATVCACAALARTLSACL- 105
            |..::.:.|.:....|...::.:..:||.|..|..|||.:.|         .|:.....|:|.: 
Yeast   303 GEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGI---------VCSPNDPDLTAAIN 358

  Fly   106 DAMTGGLARILILGRNAPANEPWPDVLGVSVVFLVTGMFMLGLEH----SRAF----------SL 156
            :|..|..:...::..|.......||::.::   |:|..|..|..:    ||.|          .:
Yeast   359 EARPGAGSSPYVIAMNNLKIRILPDIVNIA---LITAAFSAGNAYTYCSSRTFYGMALDGYAPKI 420

  Fly   157 ILTLGMFGLNAILSAVGWWRGDMLAWSADSYFQPDGISSVFLGTALLTYSFPGDWPQQLRGGRFT 221
            .......|:.....|:.      |.|:..|..|.:..|:|.|           :|          
Yeast   421 FTRCNRHGVPIYSVAIS------LVWALVSLLQLNSNSAVVL-----------NW---------- 458

  Fly   222 ATLITGLVSTSLLLTAICLSTVV-----HYRSQEDYVAVPLFNILDENGFHKLVPASACMLLLTS 281
               :..|::.|.|:..:.|..|.     .|..|:|.:....|....:       |.:|.:.|::.
Yeast   459 ---LINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWGQ-------PYTAIIGLVSC 513

  Fly   282 SAAFL-----ELFPELY 293
            ||..|     ..||:|:
Yeast   514 SAMILIQGYTVFFPKLW 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 35/181 (19%)
AGP2NP_009690.1 LysP 41..596 CDD:223903 54/277 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.