DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and SSY1

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_010444.1 Gene:SSY1 / 851738 SGDID:S000002567 Length:852 Species:Saccharomyces cerevisiae


Alignment Length:461 Identity:92/461 - (19%)
Similarity:151/461 - (32%) Gaps:168/461 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALGASVIS---YLIVYNEA--------------SAPSLLVGVVLATVYGAMAARCKTSLRSLQM 65
            |||.|.|.|   ||..||..              ||.|::|.::..::.|             ::
Yeast   372 LALPAQVSSSTFYLSYYNNVNISKGVTAGFITLFSAFSIVVNLLDVSIMG-------------EI 423

  Fly    66 PYVRATNKFDFSCLFL--------------------AIWLDALATVCACAALARTLSACLDAMTG 110
            .||...:|...:.|.:                    ..|..:.:.......|.|......||..|
Yeast   424 VYVAGISKVIIAILMVFTMIILNAGHGNDIHEGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGEG 488

  Fly   111 -------------GLARILILGRNAPANEPWPDVLGVSVVFLVTGMFM-----LGLEHSRAFSLI 157
                         ..|.::::...|        ..||.:.||.:|..:     :.....|.||::
Yeast   489 SKKGISGPKGRFLATASVMLISTFA--------FSGVEMTFLASGEAINPRKTIPSATKRTFSIV 545

  Fly   158 LTLGMFGLNAILSAVGWWRGDMLAWSAD----SYFQPDGIS-----SVFLGTALLTYSFPGDW-- 211
            |...:|    ::.:||     :..:|.|    |||  .|||     ::..||.:       ||  
Yeast   546 LISYVF----LIFSVG-----INIYSGDPRLLSYF--PGISEKRYEAIIKGTGM-------DWRL 592

  Fly   212 PQQLRGGRFTATLITGLVSTSLLLTAICLSTVVHYRSQEDYVAV------PLFNILDENGFHKLV 270
            ....|||                         :.||.    ::|      |....|...|.....
Yeast   593 RTNCRGG-------------------------IDYRQ----ISVGTGYSSPWVVALQNFGLCTFA 628

  Fly   271 PA-SACMLLLTSSAAFLELFP---ELYGI-VVRLATSEWRILSKQISYESSESGNPVLAVFIAGS 330
            .| :|.::..|::|....||.   .||.: |.|.|...:.|.||:        |.|.::| |..|
Yeast   629 SAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKR--------GVPYVSV-IFSS 684

  Fly   331 MCAMLAFAC----------PLQHLSYTLAAGHMGGVFLRALYLLYIPYRPKYMAPSSESSLSYSR 385
            :.:::|:..          .|.::|....:....|:.|..|...|...:.|.:...::||..|. 
Yeast   685 LFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYALKQRKDIISRNDSSYPYK- 748

  Fly   386 LSTAPF 391
               :||
Yeast   749 ---SPF 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 49/254 (19%)
SSY1NP_010444.1 2A0310 278..819 CDD:273334 92/461 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.