DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and CAT9

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_563754.1 Gene:CAT9 / 837104 AraportID:AT1G05940 Length:569 Species:Arabidopsis thaliana


Alignment Length:390 Identity:79/390 - (20%)
Similarity:140/390 - (35%) Gaps:68/390 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLDVLCSGSGARLALGASVISYLIVYNEASAPSLLVGVVLATVYGAMAARCKTSLRSLQMPYV-- 68
            |.|::..|.||.:..|..|::..:..:  :.|.:.:..:||.....:.|.|...|.| :.|.|  
plant    54 LFDLILLGVGASIGAGVFVVTGTVARD--AGPGVTISFLLAGASCVLNALCYAELSS-RFPAVVG 115

  Fly    69 -------RATNKFDFSCLFLAIWLD----ALATVCACAALARTLSACLDAMTGGLARILILGRNA 122
                   .|.|:.....:|:.:.||    |.:...:.|:.|..|.....|:.|.:...:..|:..
plant   116 GAYMYSYSAFNEITAFLVFVQLMLDYHIGAASISRSLASYAVALLELFPALKGSIPLWMGSGKEL 180

  Fly   123 PANEPWPDVLGVSVVFLVTGMFMLGLEHSRAFSLILTLGMFGLNAILSAVGWWRGDMLAWSADSY 187
            .......::|...::.|:|.:...|:..|.|.:.::|.....:..::...|.:..|:..||.   
plant   181 LGGLLSLNILAPILLALLTLVLCQGVRESSAVNSVMTATKVVIVLVVICAGAFEIDVANWSP--- 242

  Fly   188 FQPDGISSVFLGTALLTYSFPG----------------DWPQQLRGGRF--------TATLITGL 228
            |.|:|..:|..|..::.:|:.|                |.|..:.|...        ...::||:
plant   243 FAPNGFKAVLTGATVVFFSYVGFDAVANSAEESKNPQRDLPIGIMGSLLVCISLYIGVCLVLTGM 307

  Fly   229 VSTSLLLTAICLSTVVHYRSQEDYVAVPLFNILDENGF---HKLVPASACMLLLTSSAAFLELFP 290
            |..|||              .||   .||.......|.   ..|:...|...|.|:....|.:..
plant   308 VPFSLL--------------SED---APLAEAFSSKGMKFVSILISIGAVAGLTTTLLVGLYVQS 355

  Fly   291 ELYGIVVRLATSEWRILSKQISYESSESGNPVLAVFIAGSMCAMLAFACPLQHLSYTLAAGHMGG 355
            .||     |......:|....|........|:.:....|.:..:||....:..||:.|:.|.:.|
plant   356 RLY-----LGLGRDGLLPSIFSRIHPTLHTPLHSQIWCGIVAGVLAGIFNVHSLSHILSVGTLTG 415

  Fly   356  355
            plant   416  415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 45/215 (21%)
CAT9NP_563754.1 2A0303 42..552 CDD:273330 79/390 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43243
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.