DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tadr and CG1607

DIOPT Version :9

Sequence 1:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster


Alignment Length:601 Identity:103/601 - (17%)
Similarity:191/601 - (31%) Gaps:238/601 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TLSACLDAMTGGLARILILGRNAPANEPWPDVLGVSVVFLVTGMFMLGLEHSRAFSLILTLGMFG 164
            ||.|.:..:.|   ..:|:|          .::|..:....||:.|.      ..|:.|.|.::.
  Fly    44 TLKAKMSLLNG---CTVIVG----------SIIGSGIFVSPTGVLMY------TGSVNLALIVWV 89

  Fly   165 LNAILSAVGWW----RGDMLAWSADSYFQPDGISSVFLGTALLTYSFPGDWPQQLRGGRFTATL- 224
            ::.:.|.||.:    .|.|:..|...|             |.:..:|          |.|.|.: 
  Fly    90 ISGLFSMVGAYCYAELGTMITKSGADY-------------AYIMETF----------GPFMAFIR 131

  Fly   225 --ITGLV--STSLLLTAICLSTVVHYRSQEDYVAVPLFNILDENGFHKLVPASACMLLLTS---- 281
              |..::  ..|..:.|:..||         ||..|.|...........:.|..|:|:||.    
  Fly   132 LWIECMIVRPCSQAIVALTFST---------YVLKPFFPECTPPEDSARLLAVCCILVLTLINCW 187

  Fly   282 ----SAAFLELF--PELYGIVVRLATSEWRIL---SKQISYESSESGNPVLAV-FIAG------- 329
                :.|..::|  .:|..:.:.:||..:::.   ::..::|::::....:|: |.:|       
  Fly   188 DVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFTFENTDTKVTSIALSFYSGLFAYNGW 252

  Fly   330 ---------------SMCAMLAFACPLQHLSYTLAAGHMGGVFLRALYLLYIPYRPKYMAPSSES 379
                           ::...:|.:|.|..:.|.:|.           ...|....|..:..||..
  Fly   253 NYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMAN-----------VSFYTILSPDEVMGSSAV 306

  Fly   380 SLSYSRLS------TAP-FAKSSSYS--SAATSSSSRLKRSLWKIGLPKHSNLKKPKTKPRNKQE 435
            :::|:..:      |.| |...|::.  :....:||||                           
  Fly   307 AVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRL--------------------------- 344

  Fly   436 LEKEWLLLGEPTSPCPQREGRDVESTILSDGEPPPSDFEYPDKFDKSDSDTSTDIDAIVDEYREK 500
                 ...|                  .::|:.|                               
  Fly   345 -----FYAG------------------ANNGQMP------------------------------- 355

  Fly   501 IKVTTAGPLERSVRVPTVSSWRV---------TIFAIV-------VIGLGIA-LCIAGLMMHWAP 548
             ::.|...::|....|.|.:..:         .|||::       .:.:|:| ||:..|  .||.
  Fly   356 -EILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWL--RWAQ 417

  Fly   549 AALTGGIGV--------LIVTIMMGFIPKYTGSVINVSPVICGMSLLMGVILFSGCAIH----SW 601
            ..|...|.|        ||.||.:..:|.|      .|||..|..:||   :.|...::    :|
  Fly   418 PNLPRPIRVPMVFPIVYLIATIFVTVVPMY------ASPVETGYGILM---ILSSIPVYLVFIAW 473

  Fly   602 PGLLIWLMAGLILVIR 617
            ....||....::.:.|
  Fly   474 KNKPIWFQKTMVSLTR 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tadrNP_724308.2 2A0303 5..>209 CDD:273330 22/112 (20%)
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 103/601 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.