DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Rdh10

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_598593.1 Gene:Rdh10 / 98711 MGIID:1924238 Length:341 Species:Mus musculus


Alignment Length:307 Identity:112/307 - (36%)
Similarity:161/307 - (52%) Gaps:46/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VAW-FIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINK 120
            |.| |::....::::.        .||.:...:.||||.|:|||||.|....:....:|:||||.
Mouse    14 VLWAFVLAAARWLVRP--------KEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT 70

  Fly   121 KGIAETVQIVE--------------EAGGYCKG--------------YVVDISKKEEVYKAADVI 157
            :...||..:|.              :||   ||              |..|:.|:|.||..|:.:
Mouse    71 QSNEETAGMVRHIYRDLEAADAAALQAG---KGEEEILPPCNLQVFTYTCDVGKRENVYLTAERV 132

  Fly   158 RDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIAS 222
            |.|||::::|:||||||||.|||:.||.||||:..||..|||||||||||.|:|.:.|||.|:||
Mouse   133 RKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVAS 197

  Fly   223 LAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNAR---- 283
            ..|....:.:.|||||||..|||.|:|..||:......|:||.:||:.:. ||||.....|    
Mouse   198 SLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVD-TGMFRGCRIRKEIE 261

  Fly   284 -WVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCV 329
             ::|.|.|:....:.:.||..::.:...|..:.::...|...|:..|
Mouse   262 PFLPPLKPDYCVKQAMRAILTDQPMVCTPRLMYIVTFMKSILPFEAV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 102/249 (41%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 106/272 (39%)
Rdh10NP_598593.1 adh_short 37..252 CDD:278532 96/218 (44%)
17beta-HSDXI-like_SDR_c 38..307 CDD:187598 106/272 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1734
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.