DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and DHRS3

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_004744.2 Gene:DHRS3 / 9249 HGNCID:17693 Length:302 Species:Homo sapiens


Alignment Length:284 Identity:102/284 - (35%)
Similarity:157/284 - (55%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LQDLYYI---AFG--YPEK--ELNTDIALITGGGNGLGRLLAERLGKMGT-KVVIWDINKKGIAE 125
            ||.:|.:   |.|  .|.|  :|:.:..||||||.|:||.||....:.|. |:|:|...:|.:.|
Human    14 LQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWGRTEKCLKE 78

  Fly   126 TVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERS 190
            |.:.:.:.|..|..::.|:..:||||:.|..:|::|||||:|:|||.||.|..|:|:.|..:.:|
Human    79 TTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKS 143

  Fly   191 FNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEV 255
            .::|.:..|||||||||:|:|...|||..:.|:.....|...:|||.||.:|..|.|:|.|.|  
Human   144 QHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGL-- 206

  Fly   256 LGHTNIRTTCICPFFIQATGMFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVL 317
            |....:..|.:.||. .:|.||..:..|:   .|.|.|..||.|.:.|::.|:.|.::|..:..|
Human   207 LDCPGVSATTVLPFH-TSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHAL 270

  Fly   318 LSFKWTFPWGCVGGLLKRLVPDAS 341
            :             :||.::|.|:
Human   271 V-------------ILKSILPQAA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 87/222 (39%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 90/243 (37%)
DHRS3NP_004744.2 17beta-HSDXI-like_SDR_c 53..281 CDD:187598 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.