DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and YDL114W

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_010169.1 Gene:YDL114W / 851444 SGDID:S000002272 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:75/245 - (30%)
Similarity:117/245 - (47%) Gaps:13/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKGYVVDISKKEEVYKA 153
            ||||||.:|||..||:.|.:...||::.||..   ..|...||....:.  |..||:..:|:...
Yeast    41 ALITGGSSGLGFELAKELSRRINKVIVADIQS---FPTFAQVEYNNIFY--YQCDITSLDEIKNL 100

  Fly   154 ADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIA 218
            ...|..:.|:|.::||||||.....|....:..:|:..::|::..:.....|...||:|..|.|.
Yeast   101 KKAIERDHGNINIIINNAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGFII 165

  Fly   219 TIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVL----GHTNIRTTCICPFFIQATGMFDD 279
            .|||:.|.:..::|..|.|||.|.:||.:.:......|    ..|.|:|..:||..|: |.||.|
Yeast   166 NIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLLVCPGKIK-TNMFID 229

  Fly   280 V---NARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPW 326
            |   :....|.:.|:.:|..:|:|:..|....:...:...|:.|..|..|
Yeast   230 VPTPSKLLAPDIIPSQLALAIISAMEHNHLQTLNAPYYVNLVPFFKTLSW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 68/216 (31%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 75/245 (31%)
YDL114WNP_010169.1 17beta-HSDXI-like_SDR_c 40..282 CDD:187598 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346081
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1486
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - LDO PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
TreeFam 1 0.960 - -
1211.750

Return to query results.
Submit another query.