DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and SDR2

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:224 Identity:71/224 - (31%)
Similarity:99/224 - (44%) Gaps:16/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDI-NKKGIAETVQIVEEAGGYCKGYV- 141
            || |.|...:|:||||.:|:|:.......:.|..|||.|: |..|.:....:..........:: 
plant    28 YP-KRLEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGSSLAKSLSSHKTSPMVAFIS 91

  Fly   142 VDISKKEEVYKAADVIRDEVGDITLLINNAGVVSG----LHLLDTPDHLIERSFNVNVMAHFWTT 202
            .|:|.:.:|....:|.....|.:.:|.|||||:..    ..:||......:....|||.......
plant    92 CDVSVEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGM 156

  Fly   203 KAFLPKMIEND-RGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCI 266
            |.....||:.. :|.|.:.||:||.:|......|.|||.|.||..:....|   ||...||..||
plant   157 KHGARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACE---LGKYGIRVNCI 218

  Fly   267 CPFFIQATGMFDDVNARWVPTLNPNDVAD 295
            .||.: ||.|.  ||| |..| :..||.|
plant   219 SPFGV-ATSML--VNA-WRKT-SGGDVED 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 69/221 (31%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 67/215 (31%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 71/224 (32%)
NADB_Rossmann 31..295 CDD:304358 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.