DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and SDR3

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:236 Identity:65/236 - (27%)
Similarity:101/236 - (42%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKK-GIAETVQIVEEAGGYCKGYVVDISKK 147
            |:..||:||||.:|:|..........|.||||.|..:: |....|.:.::...:   |..|::.:
plant     6 LDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDFQEELGQNVAVSVGKDKASF---YRCDVTNE 67

  Fly   148 EEVYKAADVIRDEVGDITLLINNAGVVS--GLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMI 210
            :||..|.....::.|.:.:|.:||||:.  | ..||......:|:..|||.......|.....|:
plant    68 KEVENAVKFTVEKYGKLDVLFSNAGVMEQPG-SFLDLNLEQFDRTMAVNVRGAAAFIKHAARAMV 131

  Fly   211 E-NDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQAT 274
            | ..||.|....|:|..:|......|.|||.|.:|.   ::.....||...||...:.|:.: ||
plant   132 EKGTRGSIVCTTSVASEIGGPGPHAYTASKHALLGL---VKSACGGLGKYGIRVNGVAPYAV-AT 192

  Fly   275 GMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLK 315
            .    :|:|...|             :|..|:.:...|.||
plant   193 A----INSRDEET-------------VRMVEEYSAATGILK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 60/218 (28%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 64/232 (28%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 65/236 (28%)
NADB_Rossmann 5..252 CDD:304358 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.