DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and AT2G17845

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_565425.1 Gene:AT2G17845 / 816294 AraportID:AT2G17845 Length:312 Species:Arabidopsis thaliana


Alignment Length:312 Identity:74/312 - (23%)
Similarity:122/312 - (39%) Gaps:64/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ELNTDIALITGGGNGLGRLLAERLGKMGTKVVI----WDINKKGIAETVQIVEEAGGYCKGYVVD 143
            ||...:.|:||..:|:||.:...|.|.|.|::.    .|..|...:|..:....||...:...:|
plant    46 ELKDKVVLVTGASSGIGREVCLDLAKAGCKIIAAARRVDRLKSLCSEINRFEYSAGIQAEALELD 110

  Fly   144 ISK-----KEEVYKAADVIRDEVGDITLLINNAGVVSGL-HLLDTPDHLIERSFNVNVMAHFWTT 202
            :|.     ::.|.||.::.    |.|..||||||....: ..||..:...::.|..|:...:..:
plant   111 VSSDAATVQKAVKKAWEIF----GKIDALINNAGFRGNVKSSLDLSEDEWDKVFKTNLTGTWLVS 171

  Fly   203 K--AFLPKMIENDRGHIATIASLAG-HVG-ISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRT 263
            |  ..|.:..:...|.:..|:|::. |.| :...|.|..||   .|.|...|:....||...||.
plant   172 KYVCILMRDAKRGGGSVINISSVSWLHRGQVPGGVAYACSK---GGVDTMTRMMALELGVYKIRV 233

  Fly   264 TCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGC 328
            ..|.|..:::......:...|:.|:....|..:|        :..|.||                
plant   234 NSIAPGLLKSEITQGLMQKEWLKTVIERTVPLKV--------QQTVDPG---------------- 274

  Fly   329 VGGLLKRLVPDASPHGLPSSIAVPTVPLNSNSKLTAADIAALDAELSSVTLP 380
            :..||:.||.|:|.:            ::.|:.:       :||..|.|.||
plant   275 LTSLLRYLVHDSSKY------------ISGNTYI-------VDAGASLVGLP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 58/229 (25%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 59/253 (23%)
AT2G17845NP_565425.1 fabG 47..303 CDD:235546 69/305 (23%)
SDR_c 52..298 CDD:212491 66/295 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.