DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and rdh20

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_021332944.1 Gene:rdh20 / 555864 ZFINID:ZDB-GENE-131127-122 Length:316 Species:Danio rerio


Alignment Length:277 Identity:113/277 - (40%)
Similarity:164/277 - (59%) Gaps:7/277 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINK 120
            |:...::..:.:||:....:.|....|.::.::.||||.|..||||.|....|.|.:||:||:|.
Zfish     6 DLQVMLLDVLYFILRSCLRLVFRPRTKPIDGELVLITGSGGALGRLFALEFTKHGAEVVLWDVNG 70

  Fly   121 KGIAETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVG-DITLLINNAGVVSGLHLLDTPD 184
            :...:|.::|...||....|.||::|:||||:.||::|:||| |:|.|:||||||:|..|||.||
Zfish    71 EANEDTAKLVRARGGQAHAYTVDVTKREEVYRTADLVREEVGRDVTYLVNNAGVVAGERLLDCPD 135

  Fly   185 HLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEAL 249
            :|:||:..||..|.|||.|||||:|.:.:.|||.||||:.|....:.:.||||||||||||.|:|
Zfish   136 YLLERTLKVNCHALFWTVKAFLPQMKDKNHGHIITIASVLGLFSTACVEDYCASKFAAVGFHESL 200

  Fly   250 RLELEVLGHTNIRTTCICPFFIQATGMFDDVNAR-----WVPTLNPNDVADRVIAAIRKNEKLAV 309
            ..||.......::||.:||:.:. ||||:....|     .:|.|.|.....:.:.||..::.|..
Zfish   201 AHELLTEDLDGVKTTLVCPYIVD-TGMFEGCRIREEVALILPPLEPLYCVQQAMNAILIDQPLVC 264

  Fly   310 IPGFLKVLLSFKWTFPW 326
            ||....:....:...||
Zfish   265 IPRLTYLPFLARALLPW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 102/222 (46%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 108/245 (44%)
rdh20XP_021332944.1 17beta-HSDXI-like_SDR_c 38..282 CDD:187598 108/245 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2736
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.