DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Sdr16c6

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001102826.1 Gene:Sdr16c6 / 502939 RGDID:1562060 Length:316 Species:Rattus norvegicus


Alignment Length:285 Identity:125/285 - (43%)
Similarity:178/285 - (62%) Gaps:11/285 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AFADVAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWD 117
            |.||...|....:.|.|:.|.:.......|:::.:|.||||.|:|||||||......|..:|:||
  Rat     3 AVADTVIFFGKFLYYFLESLVFKVIPKRRKDVSGEIVLITGAGSGLGRLLAMHFANHGATLVLWD 67

  Fly   118 INKKGIAETVQIVEEAGGY-CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLD 181
            ||::|..||.::|::.|.. ...|..|.|.:.|||:.||.:|:||||:|:||||||:|:|...||
  Rat    68 INQEGNMETYKLVKQKGDVKVFAYKCDCSNRTEVYRVADQVREEVGDVTILINNAGIVTGKSFLD 132

  Fly   182 TPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFD 246
            |||||:|:||.||.::|||..|.|||.||..:.||:..|:|:||.|||:.|.||.:|||||.|..
  Rat   133 TPDHLVEKSFLVNAISHFWICKTFLPAMINANHGHLVCISSIAGVVGINGLSDYSSSKFAAFGLA 197

  Fly   247 EALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLA 308
            |:|.|||.::..|||::|.:||:||: ||||:....::   :|.|....||.::..||.:::...
  Rat   198 ESLFLELTMVRKTNIKSTIVCPYFIK-TGMFEGCKTKYPLLLPLLEQEFVAQKIFHAILEDQVYL 261

  Fly   309 VIPG------FLKVLLSFKWTFPWG 327
            :||.      |||.|:|.|.....|
  Rat   262 LIPKFAYFTLFLKQLISPKMMIALG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 107/220 (49%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 117/250 (47%)
Sdr16c6NP_001102826.1 17beta-HSDXI-like_SDR_c 38..274 CDD:187598 111/236 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.