DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and hsd17b13

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001011240.1 Gene:hsd17b13 / 496682 XenbaseID:XB-GENE-995635 Length:300 Species:Xenopus tropicalis


Alignment Length:274 Identity:110/274 - (40%)
Similarity:164/274 - (59%) Gaps:12/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LYYIAFGYPE-----------KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAE 125
            |:...:.|.|           |.:..:|.||||.|:|:||..|....|..:.:|:||||:||:.|
 Frog    11 LFIAVYSYMESFVKLFLPVNRKSVAGNIVLITGSGHGIGRRTALEFAKHESILVLWDINQKGVEE 75

  Fly   126 TVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERS 190
            |.....:.|.....:|||.|.:.::|:.|:.::.::||:.:||||||||.|...|...||.||::
 Frog    76 TADECRKLGATAYAFVVDCSTRNDIYRCAEKVKQDIGDVDILINNAGVVFGTEFLKLQDHQIEKT 140

  Fly   191 FNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEV 255
            |:||::|||||||:||..|::.|||||.|:||:||.:|:..|||||||||..|||.|:|..||::
 Frog   141 FSVNILAHFWTTKSFLSAMMKKDRGHIVTVASIAGQLGVPYLVDYCASKFGLVGFHESLTSELKL 205

  Fly   256 LGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSF 320
            ||...::|||:||.|:. ||...:.:.|..|.|...||...::..|..|:|:.::|..:|..|..
 Frog   206 LGKDGVKTTCLCPVFVN-TGFVQNPSTRVWPVLKTEDVVKCLMEGILTNKKMIIVPSSVKYSLIM 269

  Fly   321 KWTFPWGCVGGLLK 334
            ....|...:..:.|
 Frog   270 NQFLPERVIATMTK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 99/216 (46%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 105/239 (44%)
hsd17b13NP_001011240.1 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 105/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - otm48356
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.