DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and dhrs3

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001008431.1 Gene:dhrs3 / 493258 XenbaseID:XB-GENE-955324 Length:302 Species:Xenopus tropicalis


Alignment Length:248 Identity:91/248 - (36%)
Similarity:142/248 - (57%) Gaps:7/248 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KELNTDIALITGGGNGLGRLLAERLGKMGT-KVVIWDINKKGIAETVQIVEEAGGYCKGYVVDIS 145
            ::|:.|..||||||.|:||.||....|... |:::|...::.:.||.:.:::.|..|..:|.|:.
 Frog    34 RDLSGDTVLITGGGRGIGRHLAREFAKQNAKKIILWGRTERCLKETTEEIKQMGTDCSYFVCDVG 98

  Fly   146 KKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMI 210
            .:||||:.|..:|::|||:|:|:|||.||.|..|:|:.|..:.:|.::|.:..|||||||||:|:
 Frog    99 NREEVYQQAKAVREKVGDVTILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRML 163

  Fly   211 ENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATG 275
            |...|||..|.|:.....|...:|||.||.::..|.|:|.|.|  |....:..|.:.||... |.
 Frog   164 ELQNGHIVCINSVLALSAIPGAIDYCTSKASSFAFMESLTLGL--LDCPGVNATTVLPFHTN-TE 225

  Fly   276 MFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFP 325
            ||..:..|:   .|.|.|..||.:.:.|::||:...::|..:..|:..|...|
 Frog   226 MFQGMRVRFPNLFPPLKPETVATKTVEAVQKNKAFLLLPWTMHALVILKSILP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 84/220 (38%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 89/242 (37%)
dhrs3NP_001008431.1 17beta-HSDXI-like_SDR_c 53..281 CDD:187598 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.