DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG7601

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:328 Identity:73/328 - (22%)
Similarity:121/328 - (36%) Gaps:101/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QKTEPVAPAADGWRQVLW----------------NTWDAFADVAWFIICCIGYILQDLYYIAFGY 79
            |..:..||::| |..:.|                |.|..|....:                    
  Fly     4 QDMDKCAPSSD-WNVLYWVLGTVLMPVALPLAIINIWQRFQAQKF-------------------- 47

  Fly    80 PEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKGYVVD- 143
             ..:|...:.||||..:|||..||....:.|.:|::       .|...|.:|..........|| 
  Fly    48 -RNQLPGKVVLITGASSGLGESLAHVFYRAGCRVIL-------AARRTQELERVKKDLLALDVDP 104

  Fly   144 --------------------ISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIE 188
                                :::...||...|:          ||||.|:.....:..|   .::
  Fly   105 AYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDI----------LINNGGISVRADVAST---AVD 156

  Fly   189 RSFNVNVMAHFWT---TKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALR 250
            ....|.|:.:|.:   |||.||.|::...|||..|:|:.|...|.:...|.|||.|...|.::||
  Fly   157 VDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFISSVQGKFAIPQRAAYSASKHAMQAFADSLR 221

  Fly   251 LELEVLGHTNIRTTCICPFFIQ-------------ATGMFDDVNARWVPTLNPNDVADRVIAAIR 302
            .|   :.:.||..:|:.|.:|:             :.|..|:..|:   .::|:.:|:|::..|.
  Fly   222 AE---VANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTAK---GMSPDKLAERILQCIL 280

  Fly   303 KNE 305
            :.|
  Fly   281 RKE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 62/253 (25%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 63/255 (25%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 64/259 (25%)
PRK06181 53..314 CDD:235726 63/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.