DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG10425

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster


Alignment Length:315 Identity:71/315 - (22%)
Similarity:117/315 - (37%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVAWFIICCIG-----YILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVI 115
            :::|.|:.|:|     ::|  :|........:.:.....::|||..|:|..||......|..|.:
  Fly     2 ELSWEIVFCVGIAVLVHVL--VYVFVMAKKPRSIVGRHVVVTGGSKGIGLCLAVECAMKGANVTV 64

  Fly   116 WDINKKGIAETVQIVEE----------------AGGYCKGYVVDISKKEEVYKAADVIRDEVGDI 164
            ...::|.::..|.::|.                :|.|           ::|.|....|.|..|.|
  Fly    65 IARDEKMLSGAVALMEVIRQRPDQKFQYRSLDISGDY-----------DQVAKVLGEIEDSFGPI 118

  Fly   165 TLLINNAGV----------VSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIAT 219
            ..|||.||:          |..:|.|          .|||....:..|:..||||.:...|.|..
  Fly   119 YTLINCAGMAICGVFEEVSVQDVHKL----------MNVNFFGTYNCTRYVLPKMKKAGDGIIVI 173

  Fly   220 IASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNARW 284
            .||.|...||.....|.|:|:|.....|.:.:|....|   :..|...|......|..::..:: 
  Fly   174 TASQAAMFGIYGYGPYSATKYALRAMAETIAMESREHG---VSVTLAMPCDTNTPGFEEEEKSK- 234

  Fly   285 VPTLNPNDVADRVIA---AIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLLKRL 336
                 |.:.  ::|:   .:.:.|.:|  ...||..|..|:|...|....|:..|
  Fly   235 -----PRET--KIISGGGGLIEPEVMA--KAILKDALKGKFTSTVGAESWLITTL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 54/242 (22%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 62/268 (23%)
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 62/269 (23%)
adh_short 36..229 CDD:278532 53/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.