DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and naz

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:91/241 - (37%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGG---------- 135
            :.::...|.::|||.:|:|..:|:.|...|.::::...|.:.......|::...|          
  Fly    44 DNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDE 108

  Fly   136 --------YCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFN 192
                    :.:...:|:.....|:..|..:..|...|.:|:||||||.....:.|.|. .||...
  Fly   109 DDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDG-FERHSQ 172

  Fly   193 VNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRL------ 251
            ||.:|.|..|...||.:..:::|.|..:::.| |.|            |.:.||:.|.:      
  Fly   173 VNYLAPFLLTHLLLPHLQRSEQGRILFVSAHA-HQG------------AKIDFDDPLNVGTWSVK 224

  Fly   252 --ELEVLGH------------------TNIRTTCICPFFIQATGMF 277
              ..|...|                  |::...|..|..::.|..|
  Fly   225 FHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 51/240 (21%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 51/234 (22%)
nazNP_001287387.1 FabG 47..318 CDD:223959 51/238 (21%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 51/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.