DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and sdr16c5b

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_999936.1 Gene:sdr16c5b / 406799 ZFINID:ZDB-GENE-040426-2861 Length:306 Species:Danio rerio


Alignment Length:256 Identity:114/256 - (44%)
Similarity:171/256 - (66%) Gaps:6/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEA-GGYCKGYVVDIS 145
            |.::.::.|:||.|:|:|||:|....::..::|:||||:.|..||.::::|. |.....|..|.|
Zfish    32 KNVSGELVLLTGAGSGIGRLMALEFARLDARLVLWDINEDGNKETARLIKEKYGARAHTYTCDCS 96

  Fly   146 KKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMI 210
            .:||||:.|:.::.||||:|:||||||:|:|...:|:||.|||:|..||.:|||||.|||||.||
Zfish    97 DREEVYRVANQVKREVGDVTILINNAGIVTGKKFMDSPDSLIEKSMEVNSLAHFWTYKAFLPAMI 161

  Fly   211 ENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATG 275
            ..:.||:.:|||.||.:|::.|.||||||||||||.|::.|||...|...::||.:|||||. ||
Zfish   162 AGNHGHLVSIASSAGLIGVNGLADYCASKFAAVGFAESMGLELLATGCDGVKTTIVCPFFIN-TG 225

  Fly   276 MFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLL 333
            |||..|.:|   :|.|:|:....:::.|||:.:....:|..:.:::..:...|.. ||.||
Zfish   226 MFDGANTKWPRLMPILDPDYACRKIVDAIRREQVYLYMPRSIYIIIGLRNLLPTK-VGVLL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 105/220 (48%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 109/243 (45%)
sdr16c5bNP_999936.1 17beta-HSDXI-like_SDR_c 38..281 CDD:187598 109/244 (45%)
adh_short 39..233 CDD:278532 100/194 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2736
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15039
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - LDO PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.