DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and sdr16c5a

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_998043.2 Gene:sdr16c5a / 405814 ZFINID:ZDB-GENE-040426-2049 Length:306 Species:Danio rerio


Alignment Length:273 Identity:120/273 - (43%)
Similarity:175/273 - (64%) Gaps:18/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ILQDLYY-----IAFGYP--EKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAE 125
            |...:||     :.|..|  :|:::.:|.||||.|:|:|||:|.....:...:|:||||..|:.|
Zfish    11 IFLTVYYNLEAFLKFFIPLRKKDVSGEIVLITGSGSGIGRLMALEFASLDVSLVLWDINVDGLKE 75

  Fly   126 TVQIVEEAGG----YCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHL 186
            |.:.|:|.|.    |   |..|.|.:|.||:.||.::.|:||:|:||||||:|||...:||||.|
Zfish    76 TAEQVKEKGASRVHY---YQCDCSDREAVYRVADQVKSEIGDVTILINNAGIVSGKKFMDTPDAL 137

  Fly   187 IERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRL 251
            ||::..||.|:||||.|||||.|::.:.||:.::||.||.:|::.|.||||||||||||.|::.|
Zfish   138 IEKTLRVNAMSHFWTYKAFLPAMMDKNHGHLVSVASSAGLIGVNGLADYCASKFAAVGFAESVAL 202

  Fly   252 ELEVLGHTNIRTTCICPFFIQATGMFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLAVIPGF 313
            ||...|...|:||.:|||.|. ||:||....:|   :|.|.|:.||.|:::||..::...::|..
Zfish   203 ELLSAGKDGIKTTIVCPFLIN-TGLFDGCGTKWPLLMPMLEPDYVAKRIVSAILTDQVFVLLPRS 266

  Fly   314 LKVLLSFKWTFPW 326
            |..|::.|...|:
Zfish   267 LYFLMALKGVIPY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 108/223 (48%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 114/246 (46%)
sdr16c5aNP_998043.2 adh_short 37..227 CDD:278532 98/193 (51%)
17beta-HSDXI-like_SDR_c 38..280 CDD:187598 114/246 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2736
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.