DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG8888

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:345 Identity:71/345 - (20%)
Similarity:131/345 - (37%) Gaps:83/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FADVAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDI 118
            ||...||.:..:|.:|  .|:    :.:...:....||||....|...||::|..:|..|.    
  Fly    69 FAVFVWFALATVGAVL--FYH----FVKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVY---- 123

  Fly   119 NKKGIAETVQIVEEA-------GGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNA-GVVS 175
              .|....::..:||       .|..|...:|::.::.:.:||..:...      |.:.| |:.|
  Fly   124 --AGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQH------LPHGAEGLWS 180

  Fly   176 GLH---------LLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISK 231
            .:|         |...|..::.:|.::|::.....|:.||| ::....|.:..:.|     |:::
  Fly   181 VVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLP-LVRRAHGRVVFLTS-----GLNR 239

  Fly   232 LVD-----YCASKFAAVGFDEALRLELEV-------------------LGHTNIRTTCICPFFIQ 272
            :..     .||::.|...|...||.|:..                   |..|.:|.        |
  Fly   240 VPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRD--------Q 296

  Fly   273 ATGMFDDVNARWVPTLNPNDVADRVIAAIRK-NEKLAVIPGFLKVLL-SFKWTFPWGCVGGLLKR 335
            |..|::.:::....|.. .|..:..:.::.| :.:.|.|...|:||: :...|||       :.|
  Fly   297 AKQMWNQLSSEQKKTYG-EDYYEAAMTSVEKYSRQAADIQPTLRVLIDAVTRTFP-------MAR 353

  Fly   336 LVPDASPHGLPSSIAVPTVP 355
            ..|..|...|...:|....|
  Fly   354 YTPVTSSERLQIFLAEHLAP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 49/257 (19%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 58/282 (21%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 64/312 (21%)
adh_short 96..293 CDD:278532 43/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.