DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG2064

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:341 Identity:82/341 - (24%)
Similarity:128/341 - (37%) Gaps:84/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VAWFIICCIG-YILQDLYYIAFGYPEKELNTD----IALITGGGNGLGRLLAERLGKMGTKVVI- 115
            :.|.....:| |.|::  |:..|...|:  ||    :.::||...|:|:..|..:.:.|..|.: 
  Fly    13 IMWPATIGVGIYFLKE--YMQGGKFTKD--TDETGKVFIVTGANTGIGKETALEIARRGGTVYLA 73

  Fly   116 -WDINKKGIAETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHL 179
             .|:|:...|....|.|..........:|:|..:.:.|..|..:.|...:.:|||||||:.....
  Fly    74 CRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKT 138

  Fly   180 LDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLA---GHVGISKL--------- 232
            |....:  |....||.:.||..|...|..:..:....|..::|||   |.:.::.|         
  Fly   139 LTKDGY--ELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEG 201

  Fly   233 VDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRV 297
            :.|..||.|.|.|...|...||..|.|                    |||     |:|. |.|..
  Fly   202 LAYSQSKLANVLFTRELAKRLEGSGVT--------------------VNA-----LHPG-VVDTE 240

  Fly   298 IAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLLKRLVPDASPHGLPSSIAVPTVPLNSNSKL 362
            :|......:..::..|||.::   |.        |||          .|.|.|..::        
  Fly   241 LARNWAFFQTNLVKFFLKPMI---WP--------LLK----------TPKSGAQTSI-------- 276

  Fly   363 TAADIAALDAELSSVT 378
                .||||.||.:::
  Fly   277 ----YAALDPELKNIS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 59/234 (25%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 61/253 (24%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 74/310 (24%)
NADB_Rossmann 43..317 CDD:304358 73/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.