| Sequence 1: | NP_610081.3 | Gene: | CG9265 / 35369 | FlyBaseID: | FBgn0032910 | Length: | 399 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610308.2 | Gene: | CG2070 / 35706 | FlyBaseID: | FBgn0033203 | Length: | 325 | Species: | Drosophila melanogaster |
| Alignment Length: | 37 | Identity: | 10/37 - (27%) |
|---|---|---|---|
| Similarity: | 13/37 - (35%) | Gaps: | 11/37 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 INSVVLPEFIVQGVLCVFYLLTGHWFMTLLCLPYLYY 73 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9265 | NP_610081.3 | 17beta-HSDXI-like_SDR_c | 88..328 | CDD:187598 | |
| CG2070 | NP_610308.2 | Rossmann-fold NAD(P)(+)-binding proteins | 43..317 | CDD:473865 | 10/37 (27%) |
| Blue background indicates that the domain is not in the aligned region. | |||||