DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG30491

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:238 Identity:65/238 - (27%)
Similarity:98/238 - (41%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IGYILQDLYYIAFGYPEKELNT--DIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAET- 126
            :.:.::||  :..|...||.|.  .:.::||...|:|:.....:.|.|..|.:...|.|...|. 
  Fly    24 LAFFVKDL--MQGGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAR 86

  Fly   127 VQIVEEAGG---YCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIE 188
            .:||.|...   ||:  ..|::.:|.:.......:.|...:.:|||||||:.....| |.|. ||
  Fly    87 EEIVLETKNKYVYCR--QCDLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSL-TSDG-IE 147

  Fly   189 RSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLA--------GHVGISKLVD----YCASKFA 241
            ....||.|.||..|...|..:.::....|..::|||        |.:...|..|    |..||.|
  Fly   148 LQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLA 212

  Fly   242 AVGFDEALRLELEVLGHTNIRTTCICP-----FFIQATGMFDD 279
            .|.|...|...||   .||:....:.|     ..|:..|.|::
  Fly   213 NVLFTRELAKRLE---GTNVTANALHPGVVDTEIIRHMGFFNN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 62/221 (28%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 59/213 (28%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 59/217 (27%)
NADB_Rossmann 45..319 CDD:304358 59/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.