DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG6012

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:290 Identity:67/290 - (23%)
Similarity:108/290 - (37%) Gaps:74/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YILQDLYYIAFGYPE-KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQ-- 128
            |.|..:.|.:...|. ||...|.|.:||..:|:|:..|:.|.:....||:       ||.|.:  
  Fly    29 YKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKELARQNINVVL-------IARTEEKL 86

  Fly   129 --IVEE-----AGGYCKGYVVDISKKEEVYKAADVIRDEVGD--ITLLINNAGVVSGLHLLDTPD 184
              :.:|     ||...|..:.|.:|..:||   :.|..|..:  |::|:||.|:.:...||....
  Fly    87 QAVAKEIADCGAGVQTKIVIADFTKGSQVY---EHIEKETANIPISILVNNVGIATPKSLLKYNQ 148

  Fly   185 HLIERSFNVNVMAHFWTTKAFLPKMIEND-RGHIATIASLAGHVGISKLVDYCASKFAAVGFDEA 248
            ...:...:.||:|....::.|..:|..:. :|.|..:.|......:.....|.|||........|
  Fly   149 EETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLA 213

  Fly   249 LRLELEVLGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGF 313
            |..|.:             |:.|.            |..|:||.|..::.:..|:..|       
  Fly   214 LYHEAK-------------PYGIH------------VQMLSPNFVVTKINSYSRQIMK------- 246

  Fly   314 LKVLLSFKWTFPWGCVGGLLKRLVPDASPH 343
                            |||   |:|.||.:
  Fly   247 ----------------GGL---LIPSASAY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 54/228 (24%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 53/251 (21%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 61/270 (23%)
adh_short 51..243 CDD:278532 51/226 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.